Corning® 384-well Flat Clear Bottom Black Polystyrene TC-treated Microplates, Low Flange, 20 per Bag, with Lid, Sterile Product Number 3764. Page 8: Components (enunciator blinks if not at set point). SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. Products : SpectraMax M2/M2e reader, SpectraMax M5/M5e reader, Gemini XPS reader, FlexStation II (Obsolete), Gemini EM reader, FlexStation 3 reader. ) 8. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. Essentially, all UV/VIS spectrophotometric assays that are read in a conventional spectrophotometer or micro plate reader can be read in the SpectraMax Plus: DNA/RNA/protein quantitation and purity. spectraMax 340pc 384 Microplate reader. Learn more about its features, specifications, and applications in this user. Compact design. ability to detect 16 ng/well of DNA and to quantitate 50 ng of . 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. Validate the optical performance of your absorbance . Mode 96-well 384-well 1536-well Optimizedforspeed 12seconds 25seconds 50seconds Optimizedforperformance 20seconds 40seconds 80seconds Table1-1:PlateReadTimesforOn-the-FlyDetection(± 5. Handles plates with up to 384 wells. The minimum order for this item is . Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export data The SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. Shaker time: 0 to 999 seconds Temperature control: Ambient +4°C to 45°C Temperature. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. Explore how the SpectraMax i3 Multi-Mode Platform provides an unlimited breadth of application possibilities, and how it can evolve with your future needs. The technology allows automatic adjustment of good absorbance to a tube equivalent path length of 1 cm, converted to 96 or 384 tubes. This kit is optimized for Molecular Devices384 wells, the SpectraMax iD3 reader is the complete solution for all your research needs. to View Figures. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). Annual recertification of your validation plates ensure that they meet specifications and give you confidence in the performance of your instrument. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Our microplateSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Speed Read Mode. Key features 4 gain calibration failed. 0 nm increments. Double-click the unknown device with the yellow warning icon. Page 28 SpectraMax iD3 Multi-Mode Microplate Reader User Guide 4. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. Published Dec 16, 2020 | Updated Dec 16, 2020. 997 (n = 3). Multimode Reader Comparison Chart. SpectraMax® 340PC384 microplate reader provides everything needed to measure absorbance in the visible range, including temperature control, a robotics-compatible interface and SoftMax® Pro data analysis software. The SpectraMax® Gemini™ XPS Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. Corning® EcoChoice™ products are produced, packaged, and/or distributed in an environmentally friendly manner following United States Government Federal Trade Commission (FTC) Guidelines Learn More. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. Microplate Readers. More Product Information. Company Molecular Devices LLC. No accessories are needed and SoftMax® Pro Software. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. General-purpose refrigerators are ideal economical units for when precise temperature control and maintenance are not. Top detection is available for fluorescence detection on the SpectraMax M2, while top and bottom reads are possible on the SpectraMax M2 e. Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Abs 49 sec. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. This kit is optimized for Molecular DevicesMolecular Devices Microplate Reader Spectramax 384 340PC. Other recommended products. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselected wavelengthsinasinglereadmode. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. TNF standard curve. ‘StimB’ is Stimulation Buffer, included in the IP-One Gq kit. Detection modalities are shown in Table 1-1. Digital controller and display. Results were presented as mean ± standard deviation. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. Capabilities include fluorescence and luminescence readings, environmental control, cell viability assays, enzyme. , FI 45 sec. The SpectraMax iD3 reader is fully compatible with the SpectraDrop™ Micro Volume Microplate, enabling quantitation of precious low volume samples. Dimensions: 128mm (L) x 86mm (W) x. Clearance . spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software, spectramax i3 platform. Service parts for these models are not being produced and are no longer in stock. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and. Slide the tip into the nozzle, the slots are labeled 1 and 2 for injector 1 and injector 2. A preconfigured protocol with optimized reader settings enabled reading of a 384-well plate in just two minutes. , FI 45 sec. SPECTRAmax PLUS Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific pro-teins, nucleic acids, and other molecules across a wide range of concentrations. Detection of species collected on membrane plates is also. For more sample throughput, both readers can be easilySpectraMax i3x Microplate Reader, Molecular Devices (Cat# i3X) 96-well white walled clear bottom plates, Costar (Cat# 3903) Purified luciferase, Promega (Cat# E1701) 384-well solid white plates, Greiner (Cat# 655075) CHO-K1 cells, ATCC (Cat# CCL-61) Complete Growth Media Ham’s F12 Medium, Life Technologies (Cat# 11765-54)SpectraMax190,340PC384,Plus384,VersaMaxMicroplateSpectrophotometersUserGuide 8 0112-0126D ComputerIntegration. 6-, 12-,. . Qualify the absorbance performance of SpectraMax® iD3, iD5, i3, i3x, M2, M2e, M3, M4, M5, M5e, Plus 384, ABS, ABS Plus, and FlexStation 3 readers. If desired, a high-range standard curve may be prepared from 1 ng/mL to 1 μg/mL, or a low-range standard curve may be prepared from 25 pg/mL to 25 ng/mL. PathCheck sensor corrects optical pathlength & pipetting variation. SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and analysis. SpectraMax ABS Plus reader utilizes Molecular Devices PathCheck Sensor- the only patented technology. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate. The SpectraMax Plus 384 reader is equipped with an innovation patented by Molecular Devices, the PathCheck® sensor, which measures the depth of a sample in a microplate by optical path length. Temperature control and shaking included as standard. Features. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Fluorescent detection is achieved from the top, through the entire depth of sample in the microplate well. The University of Rouen in Normandy uses the SpectraMax iD3 and FlexStation 3 for calcium studies, and in. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Accessories and spare parts for microplate dispensers, Multidrop 384 and DW. Note: In this user guide, all references to SpectraMax Multi-Mode. Analyst, M5, Flex 3, and SpectraMax L readers work differently. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. 0. No accessories are needed and SoftMax® Pro Software. Molecular Devices, LLC. SpectraMax® Plus 384 provides ultrafast, full spectral range. selected when SpectraMax Plus 384 was selected in the Preferences dialog. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. It measures the optical density (OD) of samples in both 96- and 384-well. o SpectraMax M2 - Absorbance spectrum wavelength value change problem has been fixed. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 020 fmol 0. 190-1000 nm, tunable in 1 nm increments. 4 µL DNA standards. tools to expand the. dual monochRomatoRs foR assay flexibility With SpectraMax Multi-Mode Readers, there is no need to utilize expensive filters to optimize detection levels and background. Molecular Devices SpectraMax ® Quant family of dsDNA quantitation kits allows for very accurate quantitation of dsDNA in a linear range from 0. VersaMaxreads96-wellplates. Lids for a case of 200 microplates must be purchased separately. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. Measurement of tannin, iron-reactive phenolics, anthocyanin and polymeric pigment in red wine is an important part of quality control in the wine industry. For more sample throughput, the system canTo provide access to disconnect power from the instrument, maintain a 20 cm to 30 cm (7. Light Source: Xenon flash lamp. The optical system of the SpectraMax 190 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 850 nm). Supplier: Molecular Devices. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Next generation SpectraMax® absorbance microplate readers. SpectraMax and VersaMax Plate Readers Operator’s Manual — 0112-0126 Rev A SpectraMax Plus384 SpectraMax 190 SpectraMax 340PC384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. 7 are achievable. If values are present, then. o SpectraMax M2 - Instrument boot-up problem while connected to SoftMax Pro has been fixed o LMax II - Fast Kinetic read mode button icon is fixed to show the selected state. The SpectraMax M5e Micoplate Reader is the standard for UV/Visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96-well and 384-well microplates. BOE offers an extensive inventory of competitively priced Lab Equipment. Technical specifications Detection limit for ATP Glow 0200-7012 (LUM) Optimized Guaranteed* 96-well (200 µL) 1. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. AlphaScreen assays cannot be done on the SpectraMax M series, Gemini, and SpectraMax iDx (iD3/iD5) readers. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. There should be a value for 900 and 1000. What is the minimum well volume needed to run a 384 well plate? Minimum volume depends on the solution (curved vs. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Robust. Computer and software not available. You manually lift up the lid over the chamber to insert or remove a cuvette. SpectraMax ABS Plus SpectraTest ABS2 v1. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in absorbance, fluorescence, luminescence, time-resolved fluorescence (TRF), and tunable fluorescence polarization (FP) read modes. SpectraMax ® Plus 384 optics. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Light Source: Xenon flash. It is upgradeable to include a barcode reader,. View the Molecular Devices website. The SpectraMax ABS Plus Microplate Reader can run both cuvette-based and microplate based reader applications on the same instrument. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in. Applications. UV/Vis spectrophotometer & microplate reader with built-in cuvette port. Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. 0200-6262. The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. Temperature control. Instrument design, user interface capabilities, and cost play key roles in purchasing a suitable microplate reader. To prevent such interference, select the Interlaced Reading option to read every other well in a checkerboard pattern in the first run and then read the previously omitted wells in a second run. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. 5014038F 3 Contents SafetyInformation 5 Warnings,Cautions,Notes,andTips 5 Chapter1:Introduction 11 ComputerIntegration 11 Applications 12 DualPhotomultiplierTubes 12For SpectraMax iD5, i3x, and Mini readers, the read height setting should be optimized for the microplate used. SoftMax Pro. It. 6. For fluorescence intensity assays, users can select from top- or bottom-read modes for improved sensitivity in solution and cell. 1 Figure from 528 Publications Molecular Devices LLC. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold increase in throughput for medium throughput and secondary screening laboratories. The Molecular Devices SpectraMax M3 Multi-Mode Microplate Reader is a dual-monochromator, multi-detection microplate reader with full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well. SpectraMax® M2 Multi-Mode Microplate Reader MLDVM2 SpectraMax® M2e Multi-Mode Microplate Reader (top and bottom reading) MLDVM2E SpectraMax® M3 Multi-Mode Microplate Reader MLDVM3 Ordering information VWR cat. o SpectraMax M2 - Well Scan read mode - single well read coordinate problem fixed. Contact Us Phone: +1-800-635-5577 Web: Email: [email protected] are some cuvettes that have been tested in the M5 and Plus 384. 8 (W) x 15 (D)SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. The SpectraMax® M5 Multi-Mode Microplate Reader delivers single mode reader performance and can be equipped to read volumes as low as 2uL in one multimode reader package. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a. High sample correlation coefficients (R 2) make it easy to. SpectraMax® M2 and M2e Microplate Readers are the standard for UV/visible multimode reader absorbance, providing ultrafast and full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. The guidelines for cuvette use in SpectraMax instruments are the same as those that apply to any high-quality spectrophotometer. ester flash assays, in both 96- and 384-well plates. Title: SpectraMax i Series Multi-Mode Microplate Readers | Molecular Devices Author: Molecular Devices Subject: SpectraMax i Series offer the ideal solution for any application whether you are looking for an intuitive, easy-to-use reader, multi-user lab, or an upgradeable system that can adapt to support your lab s new projects. 3) This warranty covers the SPECTRAmax. spectramax id3 multi-mode microplate reader, spectramax id3, softmax pro 7 software, spectramax id3 injector system. 00 USD Tecan Infinite 200 Pro M Plex Microplate Reader - AV $14,995. Shaker time 0 to 999 seconds Temperature range Ambient +4°C to 45°C General specifications Dimensions (in. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Keywords: spectramax m2 systems, spectramax m2e systems, spectramax m2/m2e readers, pathcheck sensor, spectratest abs1 absorbance, stakmax stacker Created Date: 5/20/2019 9:24:38 AM SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. SpectraMax iD3 and iD5 Register or Sign In. 5 pg/µL to 200 ng/µL. It is an innovative way of normalizing the absorbance reading in a microplate well to that of a 1-cm cuvette. Shaking capabilities. . Description: The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Key applications**. 1. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. Detection of species collected on membrane plates is also possible. In addition, the iD5 reader can measure TRF and FP, and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter gene detection with syringe and Western blot detection. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Glad to help you. The Molecular Devices SpectraMax 384 Plus is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and microplate drawer. Regularly used for NADPH ATPase assays, and BCA assays. Published Dec 16, 2020 | Updated Dec 16, 2020. Wavelength Range. The SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. The SpectraMax M2 and M2e systems provide the multi detection microplate readers with dualmonochromators, dual-mode cuvette ports, with top & bottom reading. spr SpectraMax iD5 SpectraTest ABS2 v1. 더 많은. Chapter 1: General Information. 6 (H) x 22. An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. 1. Keywords: fluorescence polarization. 00 USDThe SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. The 1/absorptivity value for double stranded DNA at 260 nm is commonly assumed. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Contains one microplate adapter, five 24-well low volume slides, five 64-well low volume bottom slides, and five of each cover slide (2 µL and 4 µL) 0200-6267. Data can be analyzed and combined from different plates. 76358-624. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. ® reader to the computer. Paradigm spectramax manualslibSpectramax id5 Molecular devices spectramax plus 384 user manual pdf downloadShaking spectramax id3 frequently. no. For nearly 30 years, Molecular Devices has provided scientists with . The instrument reads any standard cuvette, microcuvette, test tube or 96- and 384-well standard or UV transparent microplate over a full 190 to 1000. The SpectraMax® Plus 384 adds the ability to read cuvettes. The Analyst®, FlexStation® and SpectraMax® M5/M5 e from Molecular Devices have received the LanthaScreen® Certified designation from Life Technologies which ensures that these readers are validated to strict standards in instrument setup and assay performance. 滤光片型光吸收微孔板读板机（酶标仪），简单易用，性价比高，检测结果精确. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. 0nm increments. In addition, the iD5 reader can measure TRF and FP, and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter gene detection with syringe and Western blot detection. GeneBLAzer® Compatible Microplate Reader Documentation. Expanded wavelength coverage. 00 USD BMG FLUOstar Omega Microplate Reader Unit2 - AV $10,295. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. Three low volume 24-well bottom slides. It measures the optical density (OD) of samples in both 96- and 384-well microplates at a selected wavelength for a single point in timeSpectraMax®Plus384 SpectraMax®190 SpectraMax®340PC384. 314 low lamp level warning. Molecular Devices Spectramax 384 Plus Microplate Reader is available from The Lab World Group. Pick the best speed, sensitivity, and price for your needs. QuickSync. SpectraMax ® Plus 384 optics. 020 fmol 0. SpectraMax iD3 reader is built on the same foundation that has made our entire SpectraMax microplate reader product line among the most trusted in the industry. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold increase in throughput for medium throughput and secondary screening laboratories. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. The optical performance is comparable to a top-of-the-line dedicated Which SpectraMax M Series reader do you need? SpectraMax M Series Multi-Mode Microplate Readers 5 Ordering information VWR cat. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on. Page 10 Cuvette Chamber The cuvette chamber on the SpectraMax Plus 384 is located at the right front of the instrument. An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. Normally this fluorometric assay is performed in 96-well microplates. The SoftMax® Pro Data Acquisition and Analysis Software controls Molecular Devices® spectrophotometers and absorbance, luminescence, and fluorescence microplate readers andThe absorbance at 450 nm was measured with a microplate reader (SPECTRAmax 384, Molecular Devices, United States). 0 nm increments. Community forums for Molecular Devices - SpectraMax Plus. Instrument Description and Capabilities: Fluorescence. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on the. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytesacross awiderangeofconcentrations. The optical performance is comparable to a top-of-the-line dedicated Unparalleled performance on a personalized platform. It measures the optical density (OD) of samples in both 96- and 384-well. Check: In the data table create two new columns and add the following formulas: !Pathchecklm900. Stand alone mode is not available for the VersaMax. Select ‘Water Constant’ in the Instrument Settings dialog box (Figure 3). Digital controller and display. The SpectraMax M5e Multi-Mode Microplate Reader features a triple-mode cuvette port, temperature control, microplate shaking, and the industry leading SoftMax Pro. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. Colorimetric assays. Total volume (except deep. Molecular Devices would like to introduce to you the SoftMax Pro 7, software designed to provide the simplicity, flexibility and power required for advanced. 1: SpectraMax Plus 384 components. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. SUPPORTED PLATES Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax M2 and SpectraMax M2 . SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. 0 OD for earlier models. For more sample throughput, the system can be. Meso Scale Discovery 1250 Sector Imager 2400. For. </p> <p>Tissue-culture treated microplates are supplied with lids except when supplied in a case of 200 microplates. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and convenience for a wide range of assays such as ELISAs, nucleic acid and protein quantitation, and microbial growth. SpectraMax® i3 Multi-ModeDetectionPlatform withtheSpectraMax® MiniMax™ImagingCytometer UserGuide 5025027A April2013. Temperature control and shaking included as standard. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. to View. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. It can be upgraded with modules such as imaging cytometer, western blot imager, and injectors to expand its capabilities. The EMax® Plus Microplate Reader is designed to be a versatile and robust plate reader for research laboratories. The optical performance is comparable to a top-of-the-line dedicatedDescription Microplates The SpectraMax Multi-Mode Microplate Reader can accommodate SBS- standard 6-well to 384-well microplates and strip wells. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. In case of a cuvette, the optical path is horizontal, hence. 2. SpectraMax® M5e Multi-Mode Microplate Reader performance with an integrated 8- or 16-channel pipettor into one compact benchtop reader. The SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. Note: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. Standard features include a cuvette port, spectral scanning in 1 nm increments, and up to six wavelengths per read. Each sample has a discrete sample beam and reference beam. The plate reader optics are. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. The SpectraMax Paradigm Platform was able to quantify the protein down to the low picomolar level using an AlphaLISA method (Figure 1). 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. . However, for greater flexibility, some instruments can accommodate 6- to 1536-well plate formats. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. Microplate spectrophotometers, also called microplate readers, allow researchers to analyze multiple samples in parallel using 6- to 1536-well formats, as opposed to single sample measurements. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. 2. This user guide provides detailed instructions on how to set up, run, and analyze the validation tests, as well as how to troubleshoot common issues. Related Products: SpectraMax 384 Plus UV/Vis Microplate Reader, Molecular Devices SpectraMax M2e Microplate Readers, Molecular Devices SpectraMax M5 Multi-Mode Microplate Reader,. The SpectraMax® Paradigm® Multi-Mode Microplate Reader measures absorbance, fluorescence, time-resolved fluorescence (including HTRF), fluorescence polarization, AlphaScreen®, AlphaLISA®, and luminescence assays for up to 1536-well plates. the SpectraMax iD3 is a fantastic plate reader for a wide range of assays. Monochromator wavelength selection saves you the time and trouble of ever having to change out filters. Product Specs. SpectraDrop High-Throughput Screening (HTS) Kit. We would like to show you a description here but the site won’t allow us. In these readers, RLUs are proportional to counts/sec which doesn't change with. the SpectraMax iD3 is a fantastic plate reader for a wide range of. Place the microplate on or remove it from the microplate drawer. Molecular Devices SpectraMax 384 Plus Microplate Reader. Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. SpectraMax340PC384reads96-wellplatesand384-wellplates. SpectraMax i3x Multi-Mode Microplate Reader. Fluorescence filters included in 1nm range. Monochromator, tunable 1. 316 grating motor driver faulty. For fluorescence intensity assays, the SpectraMax® M2 and M2e units feature an. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. Shaker time 0 to 999 seconds Temperature range Ambient +4°C to 45°C General specifications Dimensions (in. BioRAPTR FRD Microfluidic Workstation and SpectraMax Paradigm Multi-Mode Detection Platform” PART NUMBER: 0200-7017 0200-7018 0200-7019 (384 Std) (384 HTS) (1536 HTS) Plate 96, 384 96, 384 96, 384, formats 1536 Typical 4 min/ 384 2 min/384 8 min/1536 Throughput plate plate plate Fully enabled protocols = reduced setup timeThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. The LMax plate reader has similar calculations and its RLUs are comparable to those of LMax II 384. Fixed a problem in SpectraMax Gemini setup when switching to luminescence where range checking errors were reported incorrectly. With optimized reagents, option to operate the readers. Light Source: Xenon flash lamp. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export dataThe SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. 0nm incrementsThe SPECTRAmax™ plus 384 microplate spectrophotometer provides rapid UV/VIS measurements of a variety of analytes. For 40 years, we have partnered with scientists to help them achieve landmark discoveries. 190-1000 nm. Simplified microplate washing from single-tube dispensing to washing full 96- and 384-well plates. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. 1) All parts of the SPECTRAmax 340PC 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. Absorbance = E * C * L. For more information, please visit us at SpectraMax® M2/M2e microplate readers for use with the Transcreener® FI Assays. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. The SpectraMax M2e are multidetection microplate readers with dual-monochromators, dual-mode cuvette ports, and top- and bottom-reading capability. , FI 45 sec. If using a microplate, place it in the drawer of the SPECTRAmax PLUS, then read the plate. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. For valuable samples and higher-throughput requirements, the assays can be performed in 384-well microplates. 96-well Half Area 384- Low Volume 1536- Microplate Material 96-well Stripwell 96-well well 384-well well Clear polystyrene n n n n Solid black or white polystyrene n n n n n n Clear bottom black or white polystyrene n n n n n Polypropylene n n n Solid black or white polypropylene n n*SpectraMax Paradigm Multi-Mode Detection Platform User Guide Loading and Unloading Microplates To load or unload a microplate: 1. Shaker time 0 to 999 seconds Temperature control Ambient. These instruments measure the optical density (OD) of samples at selected wavelengths in a single read mode.